PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927165.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 547aa    MW: 62372.6 Da    PI: 9.2436
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927165.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1111.3e-3471321128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     +p G++F+P+  elv+ yL++++ +++l++   ik+++iy+++P+d+ +++    k++yfF++r++k+++g+r+ r ++ gyWka+g+d  + ++
  XP_010927165.1   7 MPTGYHFRPSPRELVKSYLRRRLLKQPLPC-GLIKDLNIYDFHPRDILSNA-PAGKHLYFFTPRKTKNPNGTRSARGINGGYWKASGRDIIIRDE 99 
                     699***************************.89**************7443.45799*************************************9 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++++  +k Lvfy+g++++g++t+W m+ey++
  XP_010927165.1 100 TRREIAHRKFLVFYEGHQRDGRRTSWRMQEYTI 132
                     *******************************86 PP

2NAM124.77.8e-391863111128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     +p G++F+P+  elv+ yL++++ +++l++   ik+++iy+++P+d+  ++    k++yfF++r+kky++g+r+ r t+ gyWka+g+d  +++k
  XP_010927165.1 186 VPTGYHFRPSPRELVKSYLRRRLLKQPLPC-GLIKDLNIYDFHPRDILGNT-RAGKHLYFFTPRKKKYPKGTRPARETNGGYWKASGRDMIIKDK 278
                     589***************************.89**************7444.45789************************************** PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++++g kk Lvf++g++++g++t+W+mhey++
  XP_010927165.1 279 NKKEIGHKKFLVFHEGHQRDGRRTSWLMHEYTI 311
                     *******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-395157IPR003441NAC domain
PROSITE profilePS5100538.8257157IPR003441NAC domain
PfamPF023655.6E-178132IPR003441NAC domain
SuperFamilySSF1019413.01E-43183336IPR003441NAC domain
PROSITE profilePS5100542.534186336IPR003441NAC domain
PfamPF023658.9E-20187311IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MASNVPMPTG YHFRPSPREL VKSYLRRRLL KQPLPCGLIK DLNIYDFHPR DILSNAPAGK  60
HLYFFTPRKT KNPNGTRSAR GINGGYWKAS GRDIIIRDET RREIAHRKFL VFYEGHQRDG  120
RRTSWRMQEY TIKEFWFPTN QNNSELGALA LCEIFSKPTL DQSRDGEVQV DEEEEEDEGM  180
ASNVPVPTGY HFRPSPRELV KSYLRRRLLK QPLPCGLIKD LNIYDFHPRD ILGNTRAGKH  240
LYFFTPRKKK YPKGTRPARE TNGGYWKASG RDMIIKDKNK KEIGHKKFLV FHEGHQRDGR  300
RTSWLMHEYT IKEFWFPTNQ NNDKLGALAL CEIYLKPTSN RSRGGELQAV EEEEGSAYSS  360
DDSDIEDNII ADRLIRPHPA QCNHDNDRRR APIAFTNECP LGSPSACGSS TARPVPSTPL  420
LGYNNMQGHN MVLIPQYILG PSGPLQPEAS YLCNRTAMPG SNPEQPDFLV HSFYCPYAPS  480
SSSGNQMMPP PQHGELPSPE FGVATASSSQ YEVSPQRMPP SQLYLEASQL MPSAFETTLW  540
PPPRPLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-27333916173NAC domain-containing protein 19
3swp_C2e-27333916173NAC domain-containing protein 19
3swp_B2e-27333916173NAC domain-containing protein 19
3swp_A2e-27333916173NAC domain-containing protein 19
3swm_D2e-27333916173NAC domain-containing protein 19
3swm_C2e-27333916173NAC domain-containing protein 19
3swm_B2e-27333916173NAC domain-containing protein 19
3swm_A2e-27333916173NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927165.10.0PREDICTED: uncharacterized protein LOC105049263
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3753123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-30NAC domain containing protein 25